PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g15280.1
Common NameLR48_Vigan02g156200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 401aa    MW: 45007.1 Da    PI: 6.9774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g15280.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+d+++++G g+W+++++  g+ R++k+c++rw +yl
   Vang06g15280.1 14 KGLWSPEEDEKLLDYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.32e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+  ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   Vang06g15280.1  67 RGAFSQEEENMIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.602965IPR017930Myb domain
SuperFamilySSF466895.62E-3012108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
CDDcd001674.79E-121761No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2665116IPR009057Homeodomain-like
SMARTSM007174.6E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.85166116IPR017930Myb domain
PfamPF002492.8E-1367111IPR001005SANT/Myb domain
CDDcd001671.80E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLDYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEENMIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRS  120
IDPNTHKPLS EVEKDKDMLP STDKTNQKAS LGSNEVSLVD HPAKALPSSE RYPLEVSTSS  180
TQELFLDRFG ATCHDNSCRP SDVVGPYFSF HHFNYGTTNM GLSANPNASL SFIPPSTSSD  240
VNNSTISSSM LHSIFPTHVK LQSNDNPSIS SDAVQNWESN NTNKSNASMQ FQSSTNFLEN  300
TWGVAESAKV NINKDAQVPL QTEQEDLKWS EYLNTPFILG NTPENQIQTS QSIYSEVKPE  360
TGFITDESCT SWHHPPPAFQ LSDVYSKNLQ RFSVTFGQTL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512306.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0L9TYC90.0A0A0L9TYC9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SQS20.0A0A0S3SQS2_PHAAN; Uncharacterized protein
STRINGGLYMA20G22230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-112myb domain protein 61
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]